Antibodies

Jump to Filters
View as table Download
Troponin C (TNNC2) Rabbit Polyclonal Antibody
TA338237

USD 539.00

5 Days

Rabbit Polyclonal Anti-TNNC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNC2 antibody is: synthetic peptide directed towards the N-terminal region of Human TNNC2. Synthetic peptide located within the following region: ISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQM
Troponin C (TNNC2) Rabbit Polyclonal Antibody
TA362225

USD 539.00

5 Days

TNNC2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TNNC2