Rabbit Polyclonal Anti-TMOD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMOD2 antibody: synthetic peptide directed towards the N terminal of human TMOD2. Synthetic peptide located within the following region: LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED |
Rabbit Polyclonal Anti-TMOD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMOD2 antibody: synthetic peptide directed towards the N terminal of human TMOD2. Synthetic peptide located within the following region: MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI |
Germany
Japan
United Kingdom
China