Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM41 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM41 Antibody: synthetic peptide directed towards the C terminal of human TRIM41. Synthetic peptide located within the following region: AQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLG

Rabbit Polyclonal Anti-KL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the n terminal of human KL. Synthetic peptide located within the following region: FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP

Rabbit Polyclonal Anti-TRIM41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the middle region of human TRIM41. Synthetic peptide located within the following region: RFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQPSLTYYVCPTDRPEFSF

Rabbit Polyclonal Anti-TRIM41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the N terminal of human TRIM41. Synthetic peptide located within the following region: MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGG

Rabbit Polyclonal Anti-TRIM41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM41 antibody: synthetic peptide directed towards the C terminal of human TRIM41. Synthetic peptide located within the following region: RGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQ

TRIM41 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRI41

TRIM41 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 421-630 of human TRIM41 (NP_291027.3).
Modifications Unmodified