Antibodies

Jump to Filters
View as table Download
TRIM17 Rabbit Polyclonal Antibody
TA336056

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRIM17 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM17 Antibody: synthetic peptide directed towards the middle region of human TRIM17. Synthetic peptide located within the following region: MKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPDATS
TRIM17 Rabbit Polyclonal Antibody
TA336057

USD 485.00

5 Days

Rabbit Polyclonal Anti-TRIM17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM17 Antibody: synthetic peptide directed towards the C terminal of human TRIM17. Synthetic peptide located within the following region: PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS