Antibodies

Jump to Filters
View as table Download
TRAPPC3 (N-term) Rabbit Polyclonal Antibody
AP54354PU-N

USD 580.00

2 Weeks

TRAPPC3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human TRAPPC3
TRAPPC3 Rabbit Polyclonal Antibody
TA315364

USD 380.00

In Stock

Rabbit polyclonal anti-TRAPPC3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TRAPPC3.
TRAPPC3 Rabbit Polyclonal Antibody
TA331302

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRAPPC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRAPPC3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAPPC3. Synthetic peptide located within the following region: TQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADV