TRAPPC3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human TRAPPC3 |
TRAPPC3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human TRAPPC3 |
Rabbit polyclonal anti-TRAPPC3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TRAPPC3. |
Rabbit Polyclonal Anti-TRAPPC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRAPPC3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRAPPC3. Synthetic peptide located within the following region: TQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADV |