Germany
Japan
United Kingdom
China
Antibodies
View as table Download
THRAP3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 926-955 amino acids from the C-terminal region of human THRAP3 |
Rabbit Polyclonal Anti-Thrap3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Thrap3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Thrap3. Synthetic peptide located within the following region: MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSVSRSRKRRLSSRSR |
Rabbit Polyclonal Anti-THRAP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3. Synthetic peptide located within the following region: GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDN |
THRAP3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human THRAP3 |
| Modifications | Unmodified |
Active filters
Target Symbol
- THRAP3