Antibodies

Jump to Filters
View as table Download
TEX19 Rabbit Polyclonal Antibody
TA335110

USD 539.00

5 Days

Rabbit polyclonal Anti-FLJ35767 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLJ35767 antibody: synthetic peptide directed towards the middle region of human FLJ35767. Synthetic peptide located within the following region: PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS
TEX19 Rabbit Polyclonal Antibody
TA357272

USD 539.00

5 Days

TEX19 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TEX19