TUFM Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 186-455 of human TUFM (NP_003312.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-TUFM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUFM antibody: synthetic peptide directed towards the middle region of human TUFM. Synthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM |
Rabbit polyclonal anti-TUFM antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TUFM. |
TUFM (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TUFM |
TUFM (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human TUFM |
TUFM Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TUFM |
Germany
Japan
United Kingdom
China
