Rabbit Polyclonal Anti-TTLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TTLL3 antibody is: synthetic peptide directed towards the C-terminal region of TTLL3. Synthetic peptide located within the following region: APVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDM |
TTLL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TTLL3 |
TTLL3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TTLL3 |
Germany
Japan
United Kingdom
China