Goat Anti-TTC8 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KEVLKQDNTHVE, from the Internal region of the protein sequence according to NP_653197.2; NP_938051.1; NP_938052.1. |
TTC8 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 17-46 amino acids from the N-terminal region of human TTC8 |
Rabbit polyclonal Anti-TTC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TTC8 antibody: synthetic peptide directed towards the N terminal of human TTC8. Synthetic peptide located within the following region: ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG |
Germany
Japan
United Kingdom
China