Antibodies

View as table Download

Rabbit polyclonal TSC22D2 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TSC22D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-62 amino acids from the N-terminal region of human TSC22D2.

Rabbit Polyclonal Anti-TSC22D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2. Synthetic peptide located within the following region: KEQIKELVERNSLLERENALLKSLSSNDQLSQLPTQQANPGSTSQQQAVI

Rabbit Polyclonal Anti-TSC22D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2. Synthetic peptide located within the following region: PVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAF

Rabbit Polyclonal Anti-TSC22D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the N terminal of human TSC22D2. Synthetic peptide located within the following region: CFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE

Rabbit Polyclonal Anti-TSC22D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2. Synthetic peptide located within the following region: ERNSLLERENALLKSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQ

Tsc22d2 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated