Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-TRIM16 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TRIM16. |
Rabbit Polyclonal Anti-TRIM16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM16 antibody is: synthetic peptide directed towards the middle region of Human TRIM16. Synthetic peptide located within the following region: GAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETP |
Rabbit Polyclonal Anti-TRIM16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM16 antibody: synthetic peptide directed towards the N terminal of human TRIM16. Synthetic peptide located within the following region: SASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAGEGKEVLCDFCLDDTR |
Rabbit Polyclonal Anti-TRIM16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM16 antibody: synthetic peptide directed towards the N terminal of human TRIM16. Synthetic peptide located within the following region: AELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKL |
Rabbit Polyclonal Anti-TRIM16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM16 antibody: synthetic peptide directed towards the N terminal of human TRIM16. Synthetic peptide located within the following region: PLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDS |
Active filters
Target Symbol
- TRIM16