Anti-TRAF3IP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human TNF receptor-associated factor 3 interacting protein 1 |
Anti-TRAF3IP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human TNF receptor-associated factor 3 interacting protein 1 |
Rabbit Polyclonal Anti-Traf3ip1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Traf3ip1 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Traf3ip1. Synthetic peptide located within the following region: VIRITGFMKGLYTDAEMKSENVKDKDAKISFLQKAIDVVMMVSGEPLAAK |
Rabbit Polyclonal Anti-Traf3ip1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Traf3ip1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GEPLAAKPARIVAGHEPERTNELLQLIGKCCLSKLSSDEAVKRVLAGDKG |
Germany
Japan
United Kingdom
China
