Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TP53BP2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 92-122 amino acids from the N-terminal region of human TP53BP2 |
Rabbit polyclonal anti-ASPP2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal sequence of human ASPP2. |
Rabbit Polyclonal Anti-TP53BP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53BP2 antibody: synthetic peptide directed towards the N terminal of human TP53BP2. Synthetic peptide located within the following region: TLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKL |
Active filters
Target Symbol
- TP53BP2