Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TMBIM1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TMBIM1. |
Antibodies
View as table Download
Rabbit polyclonal anti-TMBIM1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to the amino terminus of human TMBIM1 protein. |
Rabbit Polyclonal Anti-TMBIM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMBIM1 antibody is: synthetic peptide directed towards the N-terminal region of Human TMBIM1. Synthetic peptide located within the following region: GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR |
Active filters
Target Symbol
- TMBIM1