Antibodies

Jump to Filters
View as table Download
THSD1 Rabbit Polyclonal Antibody
TA350497

USD 380.00

In Stock

Rabbit Polyclonal Anti-THSD1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human THSD1
THSD1 Rabbit Polyclonal Antibody
TA365068

USD 380.00

4 Weeks

THSD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human THSD1
THSD1 Rabbit Polyclonal Antibody
TA331050

USD 539.00

5 Days

Rabbit polyclonal Anti-THSD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-THSD1 antibody is: synthetic peptide directed towards the middle region of Human THSD1. Synthetic peptide located within the following region: AQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVM