TACO1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TACO1 |
TACO1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TACO1 |
Rabbit Polyclonal Anti-TACO1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TACO1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TACO1. Synthetic peptide located within the following region: NLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGL |
TACO1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-297 of human TACO1 (NP_057444.2). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-Taco1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Taco1 Antibody is: synthetic peptide directed towards the middle region of Rat Taco1. Synthetic peptide located within the following region: AVAFAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNS |
TACO1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TACO1 |