Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Pan SUMO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Pan SUMO antibody recognizes all 3 SUMO isoforms, including human SUMO1, SUMO2 and SUMO3. This antibody is generated from rabbits immunized with a recombinant protein encoding full length human SUMO3. |
Rabbit Polyclonal Anti-Sumo3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Sumo3 antibody is: synthetic peptide directed towards the N-terminal region of Sumo3. Synthetic peptide located within the following region: PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR |
Rabbit anti-SUMO3 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SUMO3 |
Rabbit polyclonal anti-SUMO-3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant human SUMO-3 protein. |
Rabbit Polyclonal Anti-SUMO3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUMO3 antibody: synthetic peptide directed towards the middle region of human SUMO3. Synthetic peptide located within the following region: MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
Rabbit anti SUMO-3/Sentrin-3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human Sentrin-3 protein. This sequence is identical to human, mouse and rat. |
Active filters
Target Symbol
- SUMO 3