Antibodies

View as table Download

Rabbit Polyclonal Anti-STX19 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

STX19 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 257-288 amino acids from the C-terminal region of Human STX19.

Rabbit Polyclonal Anti-STX19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STX19 Antibody: synthetic peptide directed towards the N terminal of human STX19. Synthetic peptide located within the following region: LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR