Antibodies

View as table Download

STC1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1).
Modifications Unmodified

Rabbit Polyclonal Anti-Stc1 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Stc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Stc1. Synthetic peptide located within the following region: EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG

STC1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse STC1

STC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1).