SOX6 mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX6 mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SOX6 mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX6 mouse monoclonal antibody,clone OTI5E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SOX6 mouse monoclonal antibody,clone OTI5E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SOX6 mouse monoclonal antibody,clone OTI1E7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SOX6 mouse monoclonal antibody,clone OTI1E7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SOX6 mouse monoclonal antibody,clone OTI5E4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SOX6 mouse monoclonal antibody,clone OTI5E4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SOX6 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-SOX6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human SOX6. |
Rabbit Polyclonal Anti-SOX6 Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOX6 Antibody: synthetic peptide directed towards the middle region of human SOX6. Synthetic peptide located within the following region: YGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN |
Rabbit Polyclonal Anti-SOX6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOX6 antibody: synthetic peptide directed towards the middle region of human SOX6. Synthetic peptide located within the following region: TYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN |
Rabbit anti SOX-6 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the Internal sequence (from 80aa-120aa) of human SOX14 protein. This sequence is identical in human, mouse and rat species. |
SOX6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human SOX6 (NP_001139291.1). |
Modifications | Unmodified |
SOX6 mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |