Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
Rabbit Polyclonal Anti-SLC39A5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG |
Rabbit Polyclonal Anti-SLC39A5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS |
Rabbit Polyclonal Anti-SLC39A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC39A5 |
Active filters
Target Symbol
- SLC39A5