SLC39A5 mouse monoclonal antibody,clone OTI2F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SLC39A5 mouse monoclonal antibody,clone OTI2F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC39A5 mouse monoclonal antibody,clone OTI2F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
SLC39A5 mouse monoclonal antibody,clone OTI2F2, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
SLC39A5 mouse monoclonal antibody,clone OTI2F2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal ZIP5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZIP5 antibody was raised against a 17 amino acid synthetic peptide near the center of human ZIP5. |
SLC39A5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC39A5 |
SLC39A5 mouse monoclonal antibody,clone OTI2F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SLC39A5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG |
Rabbit Polyclonal Anti-SLC39A5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC39A5 antibody: synthetic peptide directed towards the N terminal of human SLC39A5. Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS |
Rabbit Polyclonal Anti-SLC39A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC39A5 |