SLC10A2 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide with sequence from the C-Terminus of Human SLC10A2 (NP_000443.1). |
SLC10A2 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide with sequence from the C-Terminus of Human SLC10A2 (NP_000443.1). |
Goat Anti-Slc10a2 (mouse) Antibody
Applications | IHC, PEP-ELISA |
Reactivities | Mouse (Expected from sequence similarity: Rat) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DETNKGFQPDEK, from the C Terminus of the protein sequence according to NP_035518.1. |
Rabbit Polyclonal Anti-Slc10a2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Slc10a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV |
SLC10A2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1). |
Modifications | Unmodified |