Germany
Japan
United Kingdom
China
SLC10A2 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide with sequence from the C-Terminus of Human SLC10A2 (NP_000443.1). |
Antibodies
View as table Download
Goat Anti-Slc10a2 (mouse) Antibody
| Applications | IHC, PEP-ELISA |
| Reactivities | Mouse (Expected from sequence similarity: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DETNKGFQPDEK, from the C Terminus of the protein sequence according to NP_035518.1. |
Rabbit Polyclonal Anti-Slc10a2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Slc10a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV |
SLC10A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC10A2