SKOR1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of human SKOR1 |
SKOR1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of human SKOR1 |
Rabbit polyclonal anti-Lbxcor1 antibody
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Lbxcor1 antibody: synthetic peptide directed towards the middle region of mouse Lbxcor1. Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ |