Antibodies

View as table Download

SKOR1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human SKOR1

Rabbit polyclonal anti-Lbxcor1 antibody

Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lbxcor1 antibody: synthetic peptide directed towards the middle region of mouse Lbxcor1. Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ