Rabbit polyclonal anti-SF3B4 antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SF3B4. |
Rabbit polyclonal anti-SF3B4 antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SF3B4. |
Rabbit Polyclonal Anti-SF3B4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE |
Goat Polyclonal Antibody against SF3B4
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AAGPISERNQDAT-C, from the N Terminus of the protein sequence according to NP_005841.1. |
Rabbit Polyclonal Anti-SF3B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP |
SF3B4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SF3B4 (NP_005841.1). |
Modifications | Unmodified |
Anti-SAP49 Antibody
Applications | ICC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |