Antibodies

Jump to Filters
View as table Download
SAMD7 Rabbit Polyclonal Antibody
TA350388

USD 380.00

In Stock

Rabbit Polyclonal Anti-SAMD7 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SAMD7
SAMD7 Rabbit Polyclonal Antibody
TA369336

USD 380.00

4 Weeks

SAMD7 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SAMD7
SAMD7 (Center) Rabbit Polyclonal Antibody
AP53792PU-N

USD 580.00

2 Weeks

SAMD7 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 209-238 amino acids from the Central region of Human SAMD7
SAMD7 Rabbit Polyclonal Antibody
TA334865

USD 539.00

5 Days

Rabbit Polyclonal Anti-SAMD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SAMD7 antibody is: synthetic peptide directed towards the middle region of Human SAMD7. Synthetic peptide located within the following region: ESWGQRCRRLRKNTGNQKALDSDAESSKSQAEEKILGQTHAVPYEEDHYA