SUSD5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 600-629 amino acids from the C-terminal region of human SUSD5 |
SUSD5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 600-629 amino acids from the C-terminal region of human SUSD5 |
Rabbit Polyclonal Anti-SUSD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SUSD5 Antibody is: synthetic peptide directed towards the middle region of Human SUSD5. Synthetic peptide located within the following region: PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK |