Antibodies

Jump to Filters
View as table Download
SUSD5 (C-term) Rabbit Polyclonal Antibody
AP54113PU-N

USD 580.00

2 Weeks

SUSD5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 600-629 amino acids from the C-terminal region of human SUSD5
SUSD5 Rabbit Polyclonal Antibody
TA331944

USD 539.00

5 Days

Rabbit Polyclonal Anti-SUSD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUSD5 Antibody is: synthetic peptide directed towards the middle region of Human SUSD5. Synthetic peptide located within the following region: PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK