Rabbit Polyclonal Anti-SSX4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSX4 antibody: synthetic peptide directed towards the middle region of human SSX4. Synthetic peptide located within the following region: FPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGP |
SSX4B mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSX4B mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
SSX4B mouse monoclonal antibody,clone OTI2E10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
SSX4B mouse monoclonal antibody,clone OTI2E10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SSX4 (SSX4B) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 68-97 amino acids from the Central region of human SSX4 |
Rabbit Polyclonal Anti-SSX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSX4 antibody: synthetic peptide directed towards the N terminal of human SSX4. Synthetic peptide located within the following region: NGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYM |
Rabbit Polyclonal Anti-SSX4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSX4B antibody: synthetic peptide directed towards the middle region of human SSX4B. Synthetic peptide located within the following region: MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE |
SSX4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-188 of human SSX4 (NP_005627.1). |
| Modifications | Unmodified |
SSX4B mouse monoclonal antibody,clone OTI2E10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
