Antibodies

Jump to Filters
View as table Download
SPNS2 Rabbit Polyclonal Antibody
TA335127

USD 539.00

5 Days

Rabbit polyclonal Anti-SPNS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPNS2 antibody: synthetic peptide directed towards the N terminal of human SPNS2. Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
SPNS2 Rabbit Polyclonal Antibody
AP55299PU-N

USD 680.00

5 Weeks

SPNS2 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human C-terminal region of SPNS2 protein.