Rabbit Polyclonal Anti-SP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SP3 Antibody: synthetic peptide directed towards the middle region of human SP3. Synthetic peptide located within the following region: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSS |
Rabbit polyclonal anti-SP3/4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SP3/4. |
SP3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-350 of human SP3 (NP_003102.1). |
| Modifications | Unmodified |
SP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SP3 |
Germany
Japan
United Kingdom
China
