Antibodies

View as table Download

SOX21 mouse monoclonal antibody,clone OTI7D5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SOX21 mouse monoclonal antibody,clone OTI7D5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SOX21 mouse monoclonal antibody,clone OTI7D5, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SOX21 mouse monoclonal antibody,clone OTI7D5, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal anti-SOX21 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX21 antibody: synthetic peptide directed towards the middle region of human SOX21. Synthetic peptide located within the following region: EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG

SOX21 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 167-276 of human SOX21 (NP_009015.1).
Modifications Unmodified