Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SNX15 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region ( between 222-251aa) of human SNX15. |
Goat Polyclonal Antibody against SNX15
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEILRLHLSQLPP, from the C Terminus of the protein sequence according to NP_037438.2; NP_680086.2. |
Rabbit Polyclonal Anti-Snx15 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Snx15 antibody is: synthetic peptide directed towards the C-terminal region of Rat Snx15. Synthetic peptide located within the following region: LRNEKAGAYAAALQGYQEGVHILLQGVSGDPSPTRREGVKKKAAEYLKRA |
Rabbit Polyclonal Anti-SNX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNX15 antibody is: synthetic peptide directed towards the N-terminal region of Human SNX15. Synthetic peptide located within the following region: RKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLR |
Active filters
Target Symbol
- SNX15