Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-SLC39A7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC39A7. |
Rabbit Polyclonal Anti-SLC39A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC39A7 Antibody: synthetic peptide directed towards the N terminal of human SLC39A7. Synthetic peptide located within the following region: HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP |
SLC39A7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 235-380 of human SLC39A7 (NP_008910.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC39A7