Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SLC38A2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC38A2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC38A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC38A2 Antibody: synthetic peptide directed towards the N terminal of human SLC38A2. Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI |
SLC38A2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse SLC38A2 |
Active filters
Target Symbol
- SLC38A2