Antibodies

View as table Download

SLC35E2A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SLC35E2A

Rabbit Polyclonal Anti-SLC35E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC35E2 antibody: synthetic peptide directed towards the middle region of human SLC35E2. Synthetic peptide located within the following region: AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP