Antibodies

Jump to Filters
View as table Download
SLC35D2 Rabbit Polyclonal Antibody
TA319830

USD 570.00

5 Days

Rabbit Polyclonal SLC35D2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SLC35D2 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human SLC35D2.
SLC35D2 Rabbit Polyclonal Antibody
TA333899

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC35D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC35D2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35D2. Synthetic peptide located within the following region: LIGGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLK