Rabbit Polyclonal Anti-SLC25A16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A16 Antibody: synthetic peptide directed towards the N terminal of human SLC25A16. Synthetic peptide located within the following region: KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM |
Rabbit Polyclonal Anti-SLC25A16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A16 Antibody: synthetic peptide directed towards the middle region of human SLC25A16. Synthetic peptide located within the following region: LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR |
SLC25A16 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC25A16 (NP_689920.1). |
Germany
Japan
United Kingdom
China