Anti-SLC12A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 866-1085 amino acids of human solute carrier family 12 (potassium/chloride transporters), member 4 |
Anti-SLC12A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 866-1085 amino acids of human solute carrier family 12 (potassium/chloride transporters), member 4 |
Goat Polyclonal Antibody against SLC12A4
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DPSHAPDNFRE, from the internal region of the protein sequence according to NP_005063.1. |
Rabbit Polyclonal Anti-KCC1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HAPDNFRELVHIK, corresponding to amino acid residues 998- 1010 of rat KCC1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-SLC12A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC12A4 Antibody: synthetic peptide directed towards the N terminal of human SLC12A4. Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL |
Germany
Japan
United Kingdom
China
