Rabbit Polyclonal Anti-ECD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ECD Antibody: synthetic peptide directed towards the N terminal of human ECD. Synthetic peptide located within the following region: PAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEA |
Rabbit Polyclonal Anti-ECD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ECD antibody: synthetic peptide directed towards the middle region of human ECD. Synthetic peptide located within the following region: VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK |
ECD Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ECD |
Germany
Japan
United Kingdom
China