Rabbit Polyclonal Anti-CXorf9 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXorf9 antibody: synthetic peptide directed towards the C terminal of human CXorf9. Synthetic peptide located within the following region: RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET |
Rabbit Polyclonal Anti-CXorf9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXorf9 antibody: synthetic peptide directed towards the N terminal of human CXorf9. Synthetic peptide located within the following region: KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM |
Germany
Japan
United Kingdom
China