Antibodies

View as table Download

SAMM50 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SAMM50 (NP_056195.3).
Modifications Unmodified

SAMM50 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SAMM50

Rabbit Polyclonal Anti-SAMM50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI