Antibodies

View as table Download

Rabbit Polyclonal Anti-RTN4RL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RTN4RL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human RTN4RL1. Synthetic peptide located within the following region: RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT

Rabbit Polyclonal Anti-RTN4RL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RTN4RL1 Antibody is: synthetic peptide directed towards the middle region of Human RTN4RL1. Synthetic peptide located within the following region: SPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDY

RTN4RL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-420 of human RTN4RL1 (NP_848663.1).
Modifications Unmodified

Recombinant Anti-NgR1 (Clone M5)

Applications ELISA, FC, IP, WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated