Antibodies

Jump to Filters
View as table Download
RPL30 Rabbit Polyclonal Antibody
TA314464

USD 380.00

In Stock

Rabbit polyclonal anti-RPL30 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL30.
RPL30 Rabbit Polyclonal Antibody
TA381055

USD 365.00

3 Weeks

RPL30 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human RPL30 (NP_000980.1).
Modifications Unmodified
RPL30 Rabbit Polyclonal Antibody
TA336208

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPL30 Antibody: synthetic peptide directed towards the middle region of human RPL30. Synthetic peptide located within the following region: MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE
RPL30 Rabbit Polyclonal Antibody
TA336207

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPL30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPL30 Antibody: synthetic peptide directed towards the middle region of human RPL30. Synthetic peptide located within the following region: LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA
Rpl30 Rabbit Polyclonal Antibody
TA363106

USD 539.00

5 Days

RPL30 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse RPL30