Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-RFFL antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-363 of human RFFL protein. |
Rabbit Polyclonal anti-RFFL antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFFL antibody: synthetic peptide directed towards the middle region of human RFFL. Synthetic peptide located within the following region: KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT |
Rffl Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
RFFL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human RFFL (NP_001017368.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RFFL