Antibodies

View as table Download

Mouse Monoclonal Rad51D Antibody (5B3/6)

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated

RAD51D rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 121-170 of Human Rad51D.

Rabbit Polyclonal Anti-RAD51D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51D antibody is: synthetic peptide directed towards the C-terminal region of Human RAD51D. Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM

RAD51L3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

RAD51D Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human RA51D

RAD51D Antibody - Middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD51D antibody is: synthetic peptide directed towards the Middle region of Human RA51D

Rad51D Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human Rad51D (NP_002869.3).
Modifications Unmodified