Germany
Japan
United Kingdom
China
Antibodies
View as table Download
RABGAP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 830-1069 of human RABGAP1 (NP_036329.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-RABGAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RABGAP1 antibody is: synthetic peptide directed towards the N-terminal region of Human RABGAP1. Synthetic peptide located within the following region: LSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSV |
RABGAP1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human RABGAP1 |
Active filters
Target Symbol
- RABGAP1