RPS8 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPS8. |
RPS8 Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPS8. |
Rabbit polyclonal anti-RPS8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS8. |
Rabbit Polyclonal Anti-Rps8 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Rps8 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rps8. Synthetic peptide located within the following region: KKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELE |
RPS8 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RPS8 |
RPS8 (R152) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 120-170 of Human Ribosomal Protein S8. |