Rabbit Polyclonal RNF168 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | RNF168 antibody was raised against an 18 amino acid peptide from near the carboxy terminus of human RNF168. |
Rabbit Polyclonal RNF168 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | RNF168 antibody was raised against an 18 amino acid peptide from near the carboxy terminus of human RNF168. |
Rabbit Polyclonal Anti-RNF168 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNF168 antibody: synthetic peptide directed towards the C terminal of human RNF168. Synthetic peptide located within the following region: PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA |
Rabbit polyclonal anti-RNF168 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RNF168 |
RNF168 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-571 of human RNF168 (NP_689830.2). |
Modifications | Unmodified |
Rabbit polyclonal anti-RNF168 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RNF168 |