Germany
Japan
United Kingdom
China
Antibodies
View as table Download
RND3 (Center) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human AEHE. |
Rabbit Polyclonal Anti-RND3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RND3 antibody is: synthetic peptide directed towards the C-terminal region of Human RND3. Synthetic peptide located within the following region: TLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTV |
RND3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RND3 |
Active filters
Target Symbol
- RND3