Antibodies

Jump to Filters
View as table Download
RFP2 (TRIM13) Rabbit Polyclonal Antibody
TA350134

USD 380.00

In Stock

Rabbit Polyclonal Anti-TRIM13 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TRIM13
RFP2 (TRIM13) Rabbit Polyclonal Antibody
TA334767

USD 539.00

5 Days

Rabbit Polyclonal Anti-RFP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFP2 antibody: synthetic peptide directed towards the middle region of human RFP2. Synthetic peptide located within the following region: DTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAV
KCNRG (C-term) Rabbit Polyclonal Antibody
AP52319PU-N

USD 580.00

2 Weeks

KCNRG (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 175-202 amino acids from the C-terminal region of human KCNRG
RFP2 (TRIM13) Rabbit Polyclonal Antibody
TA310079

USD 360.00

3 Weeks

Rabbit anti-TRIM13 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
RFP2 (TRIM13) Rabbit Polyclonal Antibody
TA334768

USD 485.00

5 Days

Rabbit Polyclonal Anti-RFP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFP2 antibody: synthetic peptide directed towards the middle region of human RFP2. Synthetic peptide located within the following region: KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQR